PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr9P21580_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 546aa    MW: 60831.7 Da    PI: 5.9642
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr9P21580_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.91.9e-093513881954
                            HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            Fe   ++yp+ +e+  LA+++gLt +qV++WF N R +
  GSMUA_Achr9P21580_001 351 FEHflHPYPKDSEKLMLARQTGLTRSQVSNWFINARVR 388
                            664459******************************88 PP

2BELL119.51.5e-38215286172
                   BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                            erq+lq+k + Ll +l+eVd+rYkqy++q+q+++s F+a+ag+g+akpYt+lAl++iSrhFrcL+dai++qi
  GSMUA_Achr9P21580_001 215 ERQDLQNKVSNLLGMLDEVDRRYKQYHNQMQIIVSCFDAIAGCGAAKPYTALALQTISRHFRCLRDAISGQI 286
                            799********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.3E-48161284IPR006563POX domain
PfamPF075263.8E-43167283IPR006563POX domain
PROSITE profilePS5007112.357329392IPR001356Homeobox domain
CDDcd000861.57E-12332393No hitNo description
SMARTSM003898.7E-10332396IPR001356Homeobox domain
SuperFamilySSF466892.31E-17333399IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-28335398IPR009057Homeodomain-like
PfamPF059201.4E-17349388IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 546 aa     Download sequence    Send to blast
MSMFFMMSNN QCDTTPDLCL KDQGHPPYSE SSVPADMMYL SFSNSGAYAD ASAGSTQTQQ  60
NHNELPVAST IISQGLTAGN SDILNSYPGD HAYNAWKDGR NEMLFMQTID GVSAMQNQGL  120
SLSLSTQMPV PSIQYQPNSS DISYIGSHQS TSGNVRPFRE EGFQNKSYLR AAQELLDEVI  180
NVRKALRQKA EKNQWMTPNP QDASANSSSE LSPSERQDLQ NKVSNLLGML DEVDRRYKQY  240
HNQMQIIVSC FDAIAGCGAA KPYTALALQT ISRHFRCLRD AISGQIRATR KSLGEPDSSS  300
KSVGLSRLRY IDQQLRQQRA MQQFGMMQQH AWRPQRGLPE SSVSVLRAWL FEHFLHPYPK  360
DSEKLMLARQ TGLTRSQVSN WFINARVRLW KPMIEDMYKE EFGDVEIDSN SSSENPPKLK  420
EDIQSSEDHE DLQNHATGRC QTSQMNASFL QDALAHPDGN GRFLAYQMAE LGCYGNGGVS  480
LTLGLQHCDV GLPISDNQQS LLAMRGNDGY SAAVPAGADT ADYDYANMGD QRHRFGSAHL  540
LHDFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-16338395562Homeobox protein Meis2
3k2a_B2e-16338395562Homeobox protein Meis2
4xrs_A1e-16338395158Homeobox protein Meis1
4xrs_B1e-16338395158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009418396.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_009418397.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_009418398.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_009418399.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_009418401.10.0PREDICTED: BEL1-like homeodomain protein 7
SwissprotQ9SIW11e-139BLH7_ARATH; BEL1-like homeodomain protein 7
TrEMBLM0U2B70.0M0U2B7_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr9P21580_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90138131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.11e-130BEL1-like homeodomain 7